Qingdao Shengshi Zhiyang Import and Export Co., Ltd.
 
 
LL37
  • Brand:Shengshizhiyang
  • Model:10vials/box
  • Purity:99%
  • Cas:154947-66-7
  • Createtime: 2026-06-09
  • Updatetime: 2026-07-20
Product Details
useage For laboratory research use only, applicable to studies on antimicrobial activity, innate
deliveryInfo
appearance White lyophilized powder
aliasen
supplyCapacity 100G/Day
harbor Hong Kong
minorder 1G
Payment method Alibaba, PayPal, USDT, bank card, Western Union remittance
Delivery date 7 days
Whatsapp 86 131 7158 8872
Name: LL-37
Synonyms: LL-37, LL37, CAMP; CATHELICIDIN LL 37 (HUMAN); LL-37 (trifluoroacetate salt); Antibacterial Protein LL-37 (human); Peptide LL-37; [LL-37, 37 aa]
CAS Registry number: 154947-66-7
Molecular Formula: C???H???N??O??
Molecular Weight: 4493.4 g/mol
Peptide Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Purity: ≥99% (HPLC verified)
Appearance: White lyophilized powder
Solubility: Soluble in water at 1 mg/mL
Packing: 10 vials/box
Brand: Shengshizhiyang
Use: For laboratory research use only, applicable to studies on antimicrobial activity, innate immunity, wound healing, anti-inflammatory mechanisms and related scientific experiments.
Storage: Store in a cool, dry place away from light, avoid repeated freeze-thaw cycles.
Stability: 2 years under proper storage conditions.

Contact
Phone:+852 5426 4167
Tel:--
Whatsapp:852 5426 4167