LL37|375
- Createtime: 2026-06-10
- Updatetime: 2026-07-20
Product Details
| One box |
10 vials
|
| useage |
pharmaceutical field
|
| deliveryInfo |
|
| appearance |
White freeze-dried powder
|
| aliasen |
|
| supplyCapacity |
1000G/Day
|
| harbor |
Hong Kong
|
| minorder |
10G
|
| Payment method |
Alibaba,PayPal,USDT,Bank card,Western Union
|
| Delivery date |
10 day
|
| WhatsApp |
85254264167
|
Name: LL-37 Synonyms: LL-37, LL37, CAMP; CATHELICIDIN LL 37 (HUMAN); LL-37 (trifluoroacetate salt); Antibacterial Protein LL-37 (human); Peptide LL-37; [LL-37, 37 aa] CAS Registry number: 154947-66-7 Molecular Formula: C???H???N??O?? Molecular Weight: 4493.4 g/mol Peptide Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser Purity: ≥99% (HPLC verified) Appearance: White lyophilized powder Solubility: Soluble in water at 1 mg/mL Packing: 10 vials/box Brand: Shengshizhiyang Use: For laboratory research use only, applicable to studies on antimicrobial activity, innate immunity, wound healing, anti-inflammatory mechanisms and related scientific experiments. Storage: Store in a cool, dry place away from light, avoid repeated freeze-thaw cycles. Stability: 2 years under proper storage conditions.
MOQ is sold in boxes, and each box contains 10 bottles.
Purity: >99% (HPLC verification)
Packaging Specifications: 5mg, 10mg, 15mg, 20mg, 25mg, 30mg,40mg,50mg,60mg 10 bottles/box,Customizable Labels
Payment terms:Alibaba,PayPal,USDT,Bank card,Western Union
COA available ,Factory direct supply