Qingdao Shengshi Zhiyang Import and Export Co., Ltd.
 
 
LL37 Peptide Powder
  • Brand:Shengshizhiyang
  • Model:1*1
  • Purity:99%
  • Cas:154947-66-7
  • Createtime: 2026-06-26
  • Updatetime: 2026-06-17
Product Details
One box 10 vials
useage pharmaceutical field
deliveryInfo
appearance white sterile powder
aliasen
supplyCapacity 1000G/Day
harbor Hong Kong
minorder 10G
Payment method Alibaba,PayPal,USDT,Bank card,Western Union
Delivery date 10 days
WhatsApp 85254264167
Name: LL-37
Synonyms: LL-37, LL37, CAMP; CATHELICIDIN LL 37 (HUMAN); LL-37 (trifluoroacetate salt); Antibacterial Protein LL-37 (human); Peptide LL-37; [LL-37, 37 aa]
CAS Registry number: 154947-66-7
Molecular Formula: C???H???N??O??
Molecular Weight: 4493.4 g/mol
Peptide Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Purity: ≥99% (HPLC verified)
Appearance: White lyophilized powder
Solubility: Soluble in water at 1 mg/mL
Packing: 10 vials/box
Brand: Shengshizhiyang
Use: For laboratory research use only, applicable to studies on antimicrobial activity, innate immunity, wound healing, anti-inflammatory mechanisms and related scientific experiments.
Storage: Store in a cool, dry place away from light, avoid repeated freeze-thaw cycles.
Stability: 2 years under proper storage conditions.
Contact
Phone:+852 5426 4167
Tel:--
Whatsapp:852 5426 4167