LL37-Research-grade peptide
- Createtime: 2026-07-02
- Updatetime: 2026-06-30
Product Details
| One box |
10 vials
|
| useage |
pharmaceutical field
|
| deliveryInfo |
|
| appearance |
blue fine powder
|
| aliasen |
|
| supplyCapacity |
1000G/Day
|
| harbor |
Hong Kong
|
| minorder |
10G
|
| Payment method |
Alibaba,PayPal,USDT,Bank card,Western Union
|
| Delivery date |
10 days
|
| WhatsApp |
85254264167
|
Name: LL-37
Synonyms: LL-37, LL37, CAMP; CATHELICIDIN LL 37 (HUMAN); LL-37 (trifluoroacetate salt); Antibacterial Protein LL-37 (human); Peptide LL-37; [LL-37, 37 aa]
CAS Registry number: 154947-66-7
Molecular Formula: C???H???N??O??
Molecular Weight: 4493.4 g/mol
Peptide Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Purity: ≥99% (HPLC verified)
Appearance: White lyophilized powder
Solubility: Soluble in water at 1 mg/mL
Packing: 10 vials/box
Brand: Shengshizhiyang
Use: For laboratory research use only, applicable to studies on antimicrobial activity, innate immunity, wound healing, anti-inflammatory mechanisms and related scientific experiments.
Storage: Store in a cool, dry place away from light, avoid repeated freeze-thaw cycles.
Stability: 2 years under proper storage conditions.