Qingdao Shengshi Zhiyang Import and Export Co., Ltd.
 
 
LL37-99% purity + 100% delivery
  • Brand:Shengshizhiyang
  • Model:1*1
  • Purity:99%
  • Cas:154947-66-7
  • Createtime: 2026-07-07
  • Updatetime: 2026-06-30
Product Details
One box 10 vials
useage Inhibit appetite, delay gastric emptying, promote insulin secretion, lower blood sugar
deliveryInfo
appearance White to off-white lyophilized powder
aliasen
supplyCapacity 100G/Day
harbor Hong Kong
minorder 1G
Payment method Alibaba, PayPal, USDT, bank card, Western Union remittance
Delivery date 10 days
Whatsapp 85254264167

Product Information:

Name: LL-37
Synonyms: LL-37, LL37, CAMP; CATHELICIDIN LL 37 (HUMAN); LL-37 (trifluoroacetate salt); Antibacterial Protein LL-37 (human); Peptide LL-37; [LL-37, 37 aa]
CAS Registry number: 154947-66-7
Molecular Formula: C???H???N??O??
Molecular Weight: 4493.4 g/mol
Peptide Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Purity: ≥99% (HPLC verified)
Appearance: White lyophilized powder
Solubility: Soluble in water at 1 mg/mL
Packing: 10 vials/box
Brand: Shengshizhiyang
Use: For laboratory research use only, applicable to studies on antimicrobial activity, innate immunity, wound healing, anti-inflammatory mechanisms and related scientific experiments.
Storage: Store in a cool, dry place away from light, avoid repeated freeze-thaw cycles.
Stability: 2 years under proper storage conditions.

Company Profile:

We are a pharmaceutical and chemical raw material company integrating factories and suppliers. We have a large supply of high-quality chemical raw materials directly manufactured in our own facilities, enabling you to purchase satisfactory products at the most favorable prices.

Our Advantages:

  1. 1.Safe and Fast Delivery. Most products are in ample stock. Upon payment confirmation, the goods can be shipped out promptly, and the tracking number as well as packaging details will be notified to you as soon as possible. Our products are exported in large quantities to many countries including Germany, Brazil, the United States, Spain, the United Kingdom, France, Canada, Mexico, Poland, Russia, Australia, Norway and Finland, with a monthly output of over 10,000 kilograms.We have cooperating agents in all these countries. Our designated customs clearance company will ensure that your packages pass through customs smoothly.
  2. 2.Rich Experience We are a professional manufacturer of pharmaceutical and chemical raw materials. Having focused on this field for many years,
    our products comply with BP, USP, EP and enterprise-grade standards. We guarantee that the purity of all our products is over 99%. High
    quality and purity are among the key secrets of our success, and you can enjoy our top-tier services.
  3. 3.High-quality Service. We provide enthusiastic 24-hour after-sales service and optimal delivery support. Feel free to contact your personal assistant.

Company:

Factory:

Packing and delivery:

1kg/bag, 5kg/bag or 25kg/cardboard drum or as your request
1KG: double pharmaceutical grade plastic bag inside, sealed aluminum foil bag outside
5KG: double pharmaceutical grade plastic bag inside, cardboard carton outside
25KG: double pharmaceutical grade plastic bag inside, cardboard drum outside

Delivery:

1. In-stock products are usually shipped within 3 business days.
2. For expedited delivery, please contact our sales team for specific arrangements.



Shipping Details:

1. We ship goods by DHL, Fedex, UPS, USPS, TNT, EMS, NL Post and other couriers, with weights from 10g to 1000kg and even bulk.
2. Shipping details and shipping documents will be provided and sent via email.
3. We will keep track of the shipment until the customer is well received.
4. After years of experience in export shipping, we cooperate with professional and experienced freight forwarders to ensure that the goods can be delivered safely and efficiently in a variety of ways.
100% Customs!! 100% SAFE!!

Payment Methods:

Alibaba, PayPal, USDT, bank card, Western Union remittance


How to proceed your order:

Step 1: Please let me know the items you are favorable, quantities, and the destination country.
Step 2: You confirm all detail, and offer purchasing order.
Step 3: We send the detail price of our product and offer the suitable shipping method for reference.
Step 4: You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company, address, mobile number, ZIP code and your special requirements.
Step 5: We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.
Step 6: We offer after-sales services after service after you receive your parcel.

I'm Mia, please contact me if you are interested in our products.

Whatsapp:+8525426 4167

Contact
Phone:+852 5426 4167
Tel:--
Whatsapp:852 5426 4167